ATF4 monoclonal antibody (M01), clone 2B3

SKU: orb2295738

Description

Mouse monoclonal antibody raised against a partial recombinant ATF4.

Images & Validation

• Tested Applications: ELISA, IF, WB
• Reactivity: Human, Mouse

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 2B3
• Immunogen: ATF4 (NP_001666.2, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged ATF4 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ATF4 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 monoclonal antibody (M01), clone 2B3. Lane 1: ATF4 transfected lysate(38.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_001666.2