Bacteria hspX protein

SKU: orb595063

Description

Recombinant Mycobacterium bovis 14 kDa antigen(hspX)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Non-Animal,Others

Images & Validation

• Application Notes:
  Full Length of Mature Protein

Key Properties

• Source: Baculovirus
• Biological Origin: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
• Tag: C-terminal 9xHis-tagged
• Expression Region: 2-144aa
• Protein Length: Full Length of Mature Protein
• Endotoxins: Not test.
• MW: 18.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

16 kDa antigen HSP 16.3

Quick Database Links

UniProt

P0A5B8