You have no items in your shopping cart.
Bat coronavirus 133/2005 Spike glycoprotein (His & Myc)
SKU: orb1979717
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | E. coli |
|---|---|
| Biological Origin | BtCoV |
| Biological Activity | Bat coronavirus 133/2005 Spike glycoprotein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 33.6 kDa and the accession number is Q0Q4F2. |
| Tag | N-10xHis, C-Myc |
| Expression Region | 372-611 aa |
| MW | 33.6 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | EASATGTFIEQPNVTECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVPDNVTITKPGAYGYISKCSRLTGVNQDIETPLYINPGEYSICRDFAPLGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTANLEMGFVISVQYGTGTDSVCPMLDLGDSLTITNRLGKCVDY |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide