Bat coronavirus HKU3 Spike glycoprotein (His)

SKU: orb1979715

Description

Bat coronavirus HKU3 Spike glycoprotein (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 24.3 kDa and the accession number is Q3LZX1.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: Baculovirus Insect Cells
• Biological Origin: BtCoV
• Biological Activity: Bat coronavirus HKU3 Spike glycoprotein (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 24.3 kDa and the accession number is Q3LZX1.
• Tag: C-6xHis
• Expression Region: 310-514 aa
• MW: 24.3 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q3LZX1