You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IP, WB |
|---|---|
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone No. | 8A12 |
| Immunogen | BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE.

BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in NIH/3T3.

BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in PC-12.

BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in Raw 264.7.

Detection limit for recombinant GST tagged BATF is approximately 1 ng/ml as a capture antibody.

Immunoprecipitation of BATF transfected lysate using anti-BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF MaxPab rabbit polyclonal antibody.

Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M01), clone 8A12. Lane 1: BATF transfected lysate(14.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.86 KDa).
Documents Download
Request a Document
Protocol Information
BATF monoclonal antibody (M01), clone 8A12 (orb2291543)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review