You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone No. | 1D10 |
| Immunogen | BCAS2 (NP_005863, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

BCAS2 monoclonal antibody (M01), clone 1D10 Western Blot analysis of BCAS2 expression in K-562.

Detection limit for recombinant GST tagged BCAS2 is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of BCAS2 expression in transfected 293T cell line by BCAS2 monoclonal antibody (M01), clone 1D10. Lane 1: BCAS2 transfected lysate (26.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of BCAS2 over-expressed 293 cell line, cotransfected with BCAS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BCAS2 monoclonal antibody (M01), clone 1D10 (Cat # orb2291594). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.84 KDa).
Documents Download
Request a Document
Protocol Information
BCAS2 monoclonal antibody (M01), clone 1D10 (orb2291594)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review