You have no items in your shopping cart.
BDNF purified MaxPab rabbit polyclonal antibody (D01P)
Description
Images & Validation
−| Tested Applications | PLA, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | BDNF (NP_733927.1, 1 a.a. ~ 255 a.a) full-length human protein. |
| Protein Sequence | MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Proximity Ligation Analysis of protein-protein interactions between BDNF and NTF4. HeLa cells were stained with anti-BDNF rabbit purified polyclonal 1:1200 and anti-NTF4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF MaxPab polyclonal antibody. Lane 1: BDNF transfected lysate(28.90 KDa). Lane 2: Non-transfected lysate.
Quick Database Links
NCBI Reference Sequences
−| Protein | NP_733927.1 |
|---|
Documents Download
Request a Document
BDNF purified MaxPab rabbit polyclonal antibody (D01P) (orb2295522)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review