You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT |
| Target | BHMT |
| Protein Sequence | Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
| Molecular Weight | 45kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−BHMT Rabbit Polyclonal Antibody [orb330185]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit
Human, Rat
Rabbit
Polyclonal
Unconjugated
100 μlAnti-BHMT Antibody [orb666135]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT.

Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT.

Rabbit Anti-BHMT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-BHMT Antibody, Titration: 2.5 ug/mL, Positive Control: Human Fetal Liver cell lysate.
Documents Download
Request a Document
Protocol Information
BHMT Rabbit Polyclonal Antibody (orb330184)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review![BHMT antibody [N3C3]](/images/pub/media/catalog/product/b/h/bhmt-antibody_orb556064_ifa_1.jpg)
![BHMT antibody [N3C3]](/images/pub/media/catalog/product/b/h/bhmt-antibody_orb556064_ihc_1.jpg)
![BHMT antibody [N3C3]](/images/pub/media/catalog/product/b/h/bhmt-antibody_orb556064_wb_1.jpg)
![BHMT antibody [N3C3]](/images/pub/media/catalog/product/b/h/bhmt-antibody_orb556064_wb_2.jpg)












