Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Bovine CCL8 Recombinant Protein

SKU: orb1819566

Description

The Bovine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)) (Gene ID: 281044).

Images & Validation

Key Properties

SourceYeast
Biological OriginBovine
TargetCCL8
Protein Length76
MW8.6 kDa
Purity98%
Protein SequenceQPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry