Bovine coronavirus (strain Mebus) Nucleoprotein/NP Protein (His)

SKU: orb1979662

Description

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Bovine coronavirus (strain Mebus) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 55.3 kDa and the accession number is P10527.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: E. coli
• Biological Origin: BCoV
• Biological Activity: Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Bovine coronavirus (strain Mebus) Nucleoprotein/NP Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 55.3 kDa and the accession number is P10527.
• Tag: N-6xHis
• Expression Region: 1-448 aa
• MW: 55.3 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P10527