Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar)

SKU: orb1979664

Description

Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) is expressed in Yeast.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: BCoV
• Biological Activity: Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) is expressed in Yeast.
• Tag: C-6xHis-SUMOstar
• Expression Region: 1-43 aa
• MW: 17.7 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MTTKFVFDLLAPDDILHPFNHVKLIIRPIEVEHIIIATTMPAV

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P15778