You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Bovine |
| Target | IFN alpha |
| Protein Length | 166 |
| MW | 19.0 kDa |
| Purity | 98% |
| Protein Sequence | CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Interferon alpha-G/IFNAG Protein, Bovine, Recombinant (His & SUMO) [orb1979634]
98.00%
35.2 kDa (predicted)
1 mg, 100 μg, 20 μgVaccinia Virus B18R/B19R Protein (His) [orb1955959]
97.40%
39.86 kDa (predicted); 46 kDa (reducing condition, due to glycosylation)
100 μg, 200 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide