You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Guinea pig, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7 |
| Target | BRD7 |
| Protein Sequence | Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV |
| Molecular Weight | 74kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−BRD7 Rabbit Polyclonal Antibody [orb101788]
IF, IHC-Fr, IHC-P
Bovine, Canine, Porcine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μlBRD7 Polyclonal Antibody [orb1416885]
ELISA, IF, IHC-Fr, IHC-P
Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-BRD7 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat.
Documents Download
Request a Document
Protocol Information
BRD7 Rabbit Polyclonal Antibody (orb576935)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
























