Bunyavirus La Crosse Nucleoprotein/NP Protein (His)

SKU: orb1979595

Description

Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Bunyavirus La Crosse
• Biological Activity: Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873.
• Tag: N-6xHis
• Expression Region: 1-235 aa
• MW: 28.5 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P04873