C12orf10 Rabbit Polyclonal Antibody

SKU: orb326612

Description

Rabbit polyclonal antibody to C12orf10

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Various,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf10
• Target: C12orf10
• Protein Sequence: Synthetic peptide located within the following region: PLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRL
• Molecular Weight: 41kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MST024 antibody, anti MSTP024 antibody, anti MYG antibody, anti MYG1 antibody

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C12orf10 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell, C12orf10 is supported by BioGPS gene expression data to be expressed in HEK293T.

Quick Database Links

Gene Symbol

C12orf10

UniProt

Q86UA3

RefSeq (Protein):NP_067653