You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Canine |
| Target | IL-1 beta |
| Protein Length | 152 |
| MW | 17.5 kDa |
| Purity | 98% |
| Protein Sequence | AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1F2
Similar Products
−Porcine IL-1 beta protein [orb107741]
HPLC, SDS-PAGE
Unconjugated
> 95 % by SDS-PAGE and HPLC analyses
17.6 kDa
10 μg, 100 μg, 500 μgCanine k9IL1B Protein [orb752949]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
2 μg, 10 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
