Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Canine IL-1ra protein

SKU: orb1216235

Description

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660).

Research Area

Product Categories/Products/Proteins

Images & Validation

Key Properties

SourceYeast
Biological OriginCanine
TargetIL-1ra
Protein Length149
MW16.8 kDa
Purity98%
Protein SequenceLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-1F3
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

100 μg
$ 1,200.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry