You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Canine |
| Target | IL-5 |
| Protein Length | 113 |
| MW | 13.1 kDa |
| Purity | 98% |
| Protein Sequence | VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−k9IL5 Protein [orb1471920]
Greater than 90.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
2 μg, 10 μg, 1 mgCanine IL5 Protein, His Tag [orb2698702]
> 98%, determined by SDS-PAGE
This protein contains the extracellular domain of canine IL5 (NP_001006951.1) (Met 1-Ser 134) was expressed from Baculovirus-Insect Cells.
100 μg, 50 μgIL-5 Protein, Canine, Recombinant (His) [orb1956951]
98.00%
14.54 kDa (predicted); 17-19 kDa (reducing condition, due to glycosylation)
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days