Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Canine IL-6 protein

SKU: orb1216333

Description

The Canine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-6 Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM) (Gene ID: 403985).

Research Area

Product Categories/Products/Proteins

Images & Validation

Key Properties

SourceYeast
Biological OriginCanine
TargetIL-6
Protein Length187
MW21.0 kDa
Purity98%
Protein SequenceFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Canine IL6 Protein [orb426617]

    Greater than 95.0% as determined by SDS-PAGE.

    Sf9, Baculovirus cells

    1 mg, 2 μg, 10 μg
  • Canine IL-6 Recombinant Protein [orb1820872]

    98%

    21.0 kDa

    Yeast

    5 μg
  • Canine IL-6 protein [orb633440]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    22.8 KDa

    E.Coli

    50 μg, 200 μg, 100 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

25 μg
$ 470.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry