CBS monoclonal antibody (M01), clone 3E1

SKU: orb2294999

Description

Mouse monoclonal antibody raised against a partial recombinant CBS.

Images & Validation

• Tested Applications: ELISA, IHC-P, IP, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 3E1
• Immunogen: CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

CBS monoclonal antibody (M01), clone 3E1 Western Blot analysis of CBS expression in HeLa.

CBS monoclonal antibody (M01), clone 3E1. Western Blot analysis of CBS expression in MCF-7.

Detection limit for recombinant GST tagged CBS is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml].

Immunoprecipitation of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CBS MaxPab rabbit polyclonal antibody.

Western Blot analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody (M01), clone 3E1. Lane 1: CBS transfected lysate(61 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CBS over-expressed 293 cell line, cotransfected with CBS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CBS monoclonal antibody (M01), clone 3E1 (Cat # orb2294999). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_000062