CD209 purified MaxPab rabbit polyclonal antibody (D01P)

SKU: orb2291190

This product can be custom made

Description

Rabbit polyclonal antibody raised against a full-length human CD209 protein.

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human, Mouse

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	CD209 (NP_066978.1, 1 a.a. ~ 404 a.a) full-length human protein.
Protein Sequence	MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In 1x PBS, pH 7.4
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CD209 purified MaxPab rabbit polyclonal antibody (D01P)

CD209 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD209 expression in human liver.

CD209 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD209 expression in mouse liver.

Western Blot analysis of CD209 expression in transfected 293T cell line by CD209 MaxPab polyclonal antibody. Lane 1: CD209 transfected lysate(45.80 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_066978.1

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_066978.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols