CD3D purified MaxPab rabbit polyclonal antibody (D01P)

SKU: orb2294942

Description

Rabbit polyclonal antibody raised against a full-length human CD3D protein.

Images & Validation

• Tested Applications: PLA, WB
• Reactivity: Human, Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: CD3D (NP_000723.1, 1 a.a. ~ 171 a.a) full-length human protein.
• Protein Sequence: MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

CD3D MaxPab rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.

Proximity Ligation Analysis of protein-protein interactions between CD3D and CANX. HeLa cells were stained with anti-CD3D rabbit purified polyclonal 1:1200 and anti-CANX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CD3D expression in transfected 293T cell line by CD3D MaxPab polyclonal antibody. Lane 1: CD3D transfected lysate(18.90 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_000723.1