CD3E monoclonal antibody (M04), clone 4C1

SKU: orb2294939

Description

Mouse monoclonal antibody raised against a full length recombinant CD3E.

Images & Validation

• Tested Applications: ELISA, PLA, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 4C1
• Immunogen: CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

CD3E monoclonal antibody (M04), clone 4C1 Western Blot analysis of CD3E expression in HeLa.

Detection limit for recombinant GST tagged CD3E is approximately 1 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (46.09 KDa).

Quick Database Links

RefSeq:AAH49847.1