You have no items in your shopping cart.
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | P. pastoris (Yeast) |
|---|---|
| Biological Origin | Cynomolgus |
| Biological Activity | CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7. |
| Tag | N-6xHis |
| Expression Region | 23-113 aa |
| MW | 12.5 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Cynomolgus CD3E&CD3G Protein, Fc His Tag [orb1551231]
> 95% by SDS-PAGE.
Recombinant Human BCMA/TNFRSF17 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Gln23-Thr113 (Q95LI7) ) of cynomolgus CD3E&CD3G (Accession #Q95LI5.2 & Q95LI7) fused with an Fc tag at the C-terminus.
1000 μgRecombinant Cynomolgus CD3E&CD3G Protein, hFc His Tag [orb1550354]
> 95% by SDS-PAGE.
Recombinant Human BCMA/TNFRSF17 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Gln23-Thr113 (Q95LI7) ) of cynomolgus CD3E&CD3G (Accession #Q95LI5.2 & Q95LI7) fused with an Fc tag at the C-terminus.
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days