You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IP, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone No. | 3G10-1F4 |
| Immunogen | CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CD83 monoclonal antibody (M01), clone 3G10-1F4. Western Blot analysis of CD83 expression in human colon.

Detection limit for recombinant GST tagged CD83 is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of CD83 transfected lysate using anti-CD83 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD83 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody (M01), clone 3G10-1F4. Lane 1: CD83 transfected lysate (Predicted MW: 23 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (48.29 KDa).
Documents Download
Request a Document
Protocol Information
CD83 monoclonal antibody (M01), clone 3G10-1F4 (orb2291739)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review