You have no items in your shopping cart.
Description
Images & Validation
−Item 1 of 3
| Tested Applications | ELISA, IF, IP |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone No. | 4B9 |
| Immunogen | CD8A (AAH25715, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Detection limit for recombinant GST tagged CD8A is approximately 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CD8A on HeLa cell. [antibody concentration 40 ug/ml].
Immunoprecipitation of CD8A transfected lysate using anti-CD8A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD8A MaxPab rabbit polyclonal antibody.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
IF
Immunofluorescence
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
IP
Immunoprecipitation
CD8A monoclonal antibody (M10), clone 4B9 (orb2294919)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 5-10 working days