You have no items in your shopping cart.
CD8B MaxPab rabbit polyclonal antibody (D01)
SKU: orb2294916
Description
Images & Validation
−Item 1 of 2
| Tested Applications | IP, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | CD8B (NP_757362.1, 1 a.a. ~ 243 a.a) full-length human protein. |
| Protein Sequence | MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | No additive |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Immunoprecipitation of CD8B transfected lysate using anti-CD8B MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD8B purified MaxPab mouse polyclonal antibody (B01P) (orb2294917).
Western Blot analysis of CD8B expression in transfected 293T cell line by CD8B MaxPab polyclonal antibody. Lane 1: CD8B transfected lysate(27.20 KDa). Lane 2: Non-transfected lysate.
Quick Database Links
RefSeq (Protein):NP_757362.1
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_757362.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IP
Immunoprecipitation
CD8B MaxPab rabbit polyclonal antibody (D01) (orb2294916)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days