CD8B purified MaxPab rabbit polyclonal antibody (D01P)

SKU: orb2294915

Description

Rabbit polyclonal antibody raised against a full-length human CD8B protein.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	CD8B (NP_757362.1, 1 a.a. ~ 243 a.a) full-length human protein.
Protein Sequence	MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In 1x PBS, pH 7.4
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CD8B purified MaxPab rabbit polyclonal antibody (D01P)

Western Blot analysis of CD8B expression in transfected 293T cell line by CD8B MaxPab polyclonal antibody. Lane 1: CD8B transfected lysate(27.20 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_757362.1

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_757362.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols