CDK4 monoclonal antibody (M03), clone 4F11

SKU: orb2294622

Description

Mouse monoclonal antibody raised against a partial recombinant CDK4.

Images & Validation

• Tested Applications: ELISA, IF, WB
• Reactivity: Human, Mouse

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 4F11
• Immunogen: CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Western Blot detection against Immunogen (35.97 KDa).

CDK4 monoclonal antibody (M03), clone 4F11. Western Blot analysis of CDK4 expression in 293.

CDK4 monoclonal antibody (M03), clone 4F11. Western Blot analysis of CDK4 expression in Hela S3 NE.

Detection limit for recombinant GST tagged CDK4 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CDK4 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of CDK4 expression in transfected 293T cell line by CDK4 monoclonal antibody (M03), clone 4F11. Lane 1: CDK4 transfected lysate(33.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CDK4 over-expressed 293 cell line, cotransfected with CDK4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK4 monoclonal antibody (M03) clone 4F11 (Cat # orb2294622). GAPDH (36.1 kDa) used as specificity and loading control.

Quick Database Links

RefSeq:AAH03644