CDK6 monoclonal antibody (M01), clone 8H4

SKU: orb2294603

Description

Mouse monoclonal antibody raised against a partial recombinant CDK6.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, PLA, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 8H4
• Immunogen: CDK6 (NP_001250, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

CDK6 monoclonal antibody (M01), clone 8H4 Western Blot analysis of CDK6 expression in Jurkat.

CDK6 monoclonal antibody (M01), clone 8H4. Western Blot analysis of CDK6 expression in PC-12.

Detection limit for recombinant GST tagged CDK6 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CDK2 and CDK6. HeLa cells were stained with anti-CDK2 rabbit purified polyclonal 1:1200 and anti-CDK6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody (M01), clone 8H4. Lane 1: CDK6 transfected lysate(36.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.41 KDa).

Quick Database Links

RefSeq (Protein):NP_001250