You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, PLA, WB |
|---|---|
| Reactivity | Human, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone No. | 8H4 |
| Immunogen | CDK6 (NP_001250, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CDK6 monoclonal antibody (M01), clone 8H4 Western Blot analysis of CDK6 expression in Jurkat.

CDK6 monoclonal antibody (M01), clone 8H4. Western Blot analysis of CDK6 expression in PC-12.

Detection limit for recombinant GST tagged CDK6 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CDK2 and CDK6. HeLa cells were stained with anti-CDK2 rabbit purified polyclonal 1:1200 and anti-CDK6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody (M01), clone 8H4. Lane 1: CDK6 transfected lysate(36.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.41 KDa).
Documents Download
Request a Document
Protocol Information
CDK6 monoclonal antibody (M01), clone 8H4 (orb2294603)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review