CDKB1-2 Protein, Arabidopsis thaliana, Recombinant (His)

SKU: orb1979829

Description

Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata. In collaboration with MYB124 and MYB88, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage. CDKB1-2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.6 kDa and the accession number is Q2V419.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Arabidopsis thaliana
• Biological Activity: Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata. In collaboration with MYB124 and MYB88, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage. CDKB1-2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.6 kDa and the accession number is Q2V419.
• Tag: N-6xHis
• Expression Region: 1-311 aa
• MW: 37.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q2V419