You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Cancer,Epigenetics,Signaling Pathways/Apoptotic,Neuroscience,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Various,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/Tissue Specific & Cell Marker,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−Item 1 of 4
| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CEACAM6 |
| Target | CEACAM6 |
| Protein Sequence | Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP |
| Molecular Weight | 38kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−NCA, CEAL, CD66c
Similar Products
−- Item 1 of 3
Anti-CD66a/b/c Antibody [orb665643]
IF, IH, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 0.5 ug/ml.
Rabbit Anti-CEACAM6 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-CEACAM6 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
CEACAM6 Rabbit Polyclonal Antibody (orb578095)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 3-7 working days