Chikungunya virus (strain S27-African prototype) Non-structural protein 4 (His)

SKU: orb1979526

Description

Chikungunya virus (strain S27-African prototype) Non-structural protein 4 (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q8JUX6.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: E. coli
• Biological Origin: CHIKV
• Biological Activity: Chikungunya virus (strain S27-African prototype) Non-structural protein 4 (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q8JUX6.
• Tag: N-6xHis
• Expression Region: 2228-2474 aa
• MW: 31.1 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q8JUX6