CIDEA monoclonal antibody (M01), clone 4B9

SKU: orb2294409

Description

Mouse monoclonal antibody raised against a full length recombinant CIDEA.

Images & Validation

• Tested Applications: ELISA, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 4B9
• Immunogen: CIDEA (AAH31896, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged CIDEA is 1 ng/ml as a capture antibody.

Immunoprecipitation of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.

Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA monoclonal antibody (M01), clone 4B9. Lane 1: CIDEA transfected lysate(28.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (53.57 KDa).

Quick Database Links

RefSeq:AAH31896