CLEC4M Rabbit Polyclonal Antibody

SKU: orb325006

Description

Rabbit polyclonal antibody to CLEC4M

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Infectious Diseases,Product Categories/Antibodies,Immunology,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Tissue Specific & Cell Marker,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human CLEC4M
Target	CLEC4M
Protein Sequence	Synthetic peptide located within the following region: NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS
Molecular Weight	45kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti CD209L antibody, anti CD299 antibody, anti DC-SIGN2 antibody, anti DC-SIGNR antibody, anti DCSIGNR antibody, anti HP10347 antibody, anti L-SIGN antibody, anti LSIGN antibody, anti MGC129964 antibody, anti MGC47866 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-CLEC4M Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human kidney.

Quick Database Links

Gene Symbol

CLEC4M

UniProt

Q9H2X3

RefSeq (Protein):NP_055072

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055072

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols