CLIC3 monoclonal antibody (M02), clone 3F8

SKU: orb2291791

Description

Mouse monoclonal antibody raised against a partial recombinant CLIC3.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 3F8
• Immunogen: CLIC3 (NP_004660, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

CLIC3 monoclonal antibody (M02), clone 3F8 Western Blot analysis of CLIC3 expression in A-431.

Detection limit for recombinant GST tagged CLIC3 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CLIC3 on HeLa cell. [antibody concentration 15 ug/ml]

Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Immunoprecipitation of CLIC3 transfected lysate using anti-CLIC3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLIC3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CLIC3 expression in transfected 293T cell line by CLIC3 monoclonal antibody (M02), clone 3F8. Lane 1: CLIC3 transfected lysate (26.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_004660