You have no items in your shopping cart.
CNTF purified MaxPab mouse polyclonal antibody (B01P)
SKU: orb2294283
Description
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Polyclonal |
| Immunogen | CNTF (NP_000605.1, 1 a.a. ~ 200 a.a) full-length human protein. |
| Protein Sequence | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western Blot analysis of CNTF expression in transfected 293T cell line by CNTF MaxPab polyclonal antibody. Lane 1: CNTF transfected lysate(22 KDa). Lane 2: Non-transfected lysate.
Quick Database Links
RefSeq (Protein):NP_000605.1
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_000605.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
CNTF purified MaxPab mouse polyclonal antibody (B01P) (orb2294283)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review