COX4I2 monoclonal antibody (M01), clone 1F2

SKU: orb2290737

Description

Mouse monoclonal antibody raised against a partial recombinant COX4I2.

Images & Validation

• Tested Applications: ELISA, IHC-P, IP, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 1F2
• Immunogen: COX4I2 (NP_115998, 21 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKT
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Western Blot detection against Immunogen (34.98 KDa).

COX4I2 monoclonal antibody (M01), clone 1F2. Western Blot analysis of COX4I2 expression in PC-12.

Detection limit for recombinant GST tagged COX4I2 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

Immunoprecipitation of COX4I2 transfected lysate using anti-COX4I2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with COX4I2 MaxPab rabbit polyclonal antibody.

Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 monoclonal antibody (M01), clone 1F2. Lane 1: COX4I2 transfected lysate (Predicted MW: 20 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_115998