You have no items in your shopping cart.
COX5B purified MaxPab mouse polyclonal antibody (B01P)
Description
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Polyclonal |
| Immunogen | COX5B (NP_001853.2, 1 a.a. ~ 129 a.a) full-length human protein. |
| Protein Sequence | MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in HepG2.

COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in human pancreas.

Immunofluorescence of purified MaxPab antibody to COX5B on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of COX5B expression in transfected 293T cell line by COX5B MaxPab polyclonal antibody. Lane 1: COX5B transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate.
Quick Database Links
NCBI Reference Sequences
−| Protein | NP_001853.2 |
|---|
Documents Download
Request a Document
Protocol Information
COX5B purified MaxPab mouse polyclonal antibody (B01P) (orb2294236)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review