You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, PLA, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone No. | 4B5 |
| Immunogen | CRKL (NP_005198, 204 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged CRKL is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with anti-GAB1 rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between HCK and CRKL. Mahlavu cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with anti-PTK2 rabbit purified polyclonal 1:600 and anti-CRKL mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody (M03), clone 4B5. Lane 1: CRKL transfected lysate(33.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody (M03), clone 4B5 (Cat # orb2294140). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).
Documents Download
Request a Document
Protocol Information
CRKL monoclonal antibody (M03), clone 4B5 (orb2294140)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review