CSF1R monoclonal antibody (M02), clone 3G12

SKU: orb2294065

Description

Mouse monoclonal antibody raised against a partial recombinant CSF1R.

Images & Validation

• Tested Applications: ELISA, PLA, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 3G12
• Immunogen: CSF1R (AAH47521, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

CSF1R monoclonal antibody (M02), clone 3G12 Western Blot analysis of CSF1R expression in Hela S3 NE.

Detection limit for recombinant GST tagged CSF1R is approximately 0.3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and CSF1R. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.63 KDa).

Quick Database Links

RefSeq:AAH47521