You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IHC-P, IP, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone No. | 3A3 |
| Immunogen | CSK (NP_004374, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CSK monoclonal antibody (M01), clone 3A3 Western Blot analysis of CSK expression in HL-60.

CSK monoclonal antibody (M01), clone 3A3. Western Blot analysis of CSK expression in Hela S3 NE.

Detection limit for recombinant GST tagged CSK is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]

Immunoprecipitation of CSK transfected lysate using anti-CSK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CSK MaxPab rabbit polyclonal antibody.

Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody (M01), clone 3A3. Lane 1: CSK transfected lysate (50.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody (M01) clone 3A3 (Cat # orb2294035). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).
Documents Download
Request a Document
Protocol Information
CSK monoclonal antibody (M01), clone 3A3 (orb2294035)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review