CTGF/CCN2 Protein, Human, Recombinant (His)

SKU: orb1978845

Description

Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. CTGF/CCN2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.1 kDa and the accession number is P29279.

Research Area

,Recombinant-Protein

Images & Validation

−

Application Notes	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

−

Expression System	E. coli
Biological Origin	Human
Biological Activity	Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. CTGF/CCN2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.1 kDa and the accession number is P29279.
Tag	N-6xHis
Expression Region	253-349 aa
MW	15.1 kDa (predicted)
Purity	98.00%
Protein Sequence	GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Storage & Handling

−

Storage	-20°C
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Recombinant Human CTGF / CCN2 Protein, Avi His Tag [orb1550552]

Purity:	> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC
Source:	Recombinant Human CTGF / CCN2 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Gln27-Ala349) of Human CTGF / CCN2 fused with a His Tag at the C-terminal.

Sizes Available: 100 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P29279

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols