CTNNB1 monoclonal antibody (M02), clone 1C9

SKU: orb2293934

Description

Mouse monoclonal antibody raised against a partial recombinant CTNNB1.

Images & Validation

• Tested Applications: ELISA, IF, PLA, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 1C9
• Immunogen: CTNNB1 (AAH58926, 682 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged CTNNB1 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10 ug/ml]

PC-3 MM2 cells were stained with CTNNB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).

Proximity Ligation Analysis of protein-protein interactions between FLT1 and CTNNB1. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with anti-GSK3B rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody (M02), clone 1C9. Lane 1: CTNNB1 transfected lysate (85.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CTNNB1 over-expressed 293 cell line, cotransfected with CTNNB1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CTNNB1 monoclonal antibody (M02), clone 1C9 (Cat # orb2293934). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq:AAH58926