You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Methylation,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CXXC1 |
| Target | CXXC1 |
| Protein Sequence | Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR |
| Molecular Weight | 76kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik
Similar Products
−Anti-CGBP Antibody [orb340979]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlCXXC1 Rabbit Polyclonal Antibody [orb574295]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].








