DLST monoclonal antibody (M01), clone 4D7

SKU: orb2293598

Description

Mouse monoclonal antibody raised against a partial recombinant DLST.

Images & Validation

• Tested Applications: ELISA, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b Kappa
• Clone No.: 4D7
• Immunogen: DLST (NP_001924, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAE
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged DLST is 0.3 ng/ml as a capture antibody.

DLST monoclonal antibody (M01), clone 4D7. Western Blot analysis of DLST expression in PC-12.

Western Blot analysis of DLST expression in transfected 293T cell line by DLST monoclonal antibody (M01), clone 4D7. Lane 1: DLST transfected lysate (Predicted MW: 48.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).

Quick Database Links

RefSeq (Protein):NP_001924