EEF1G monoclonal antibody (M01), clone 3F11-1A10

SKU: orb2293323

Description

Mouse monoclonal antibody raised against a full length recombinant EEF1G.

Images & Validation

• Tested Applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 kappa
• Clone No.: 3F11-1A10
• Immunogen: EEF1G (AAH15813.1, 1 a.a. ~ 437 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

EEF1G monoclonal antibody (M01), clone 3F11-1A10 Western Blot analysis of EEF1G expression in HL-60.

EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in 293.

EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in HepG2.

EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in NIH/3T3.

EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in PC-12.

EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in Raw 264.7.

Immunofluorescence of monoclonal antibody to EEF1G on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of EEF1G expression in transfected 293T cell line by EEF1G monoclonal antibody (M01), clone 3F11-1A10. Lane 1: EEF1G transfected lysate (50 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of EEF1G over-expressed 293 cell line, cotransfected with EEF1G Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with EEF1G monoclonal antibody (M01), clone 3F11-1A10 (Cat # orb2293323). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (73.59 KDa).

Quick Database Links

RefSeq:AAH15813.1