You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone No. | 4B7 |
| Immunogen | EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged EHD3 is approximately 0.1 ng/ml as a capture antibody.

EHD3 monoclonal antibody (M01), clone 4B7 Western Blot analysis of EHD3 expression in IMR-32.

EHD3 monoclonal antibody (M01), clone 4B7. Western Blot analysis of EHD3 expression in COLO 320 HSR.

EHD3 monoclonal antibody (M01), clone 4B7. Western Blot analysis of EHD3 expression in MCF-7.

Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25 ug/ml]

Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (31.24 KDa).
Documents Download
Request a Document
Protocol Information
EHD3 monoclonal antibody (M01), clone 4B7 (orb2291189)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review