You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, PLA, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone No. | 3B1 |
| Immunogen | ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged ERBB2 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ERBB2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunofluorescence of monoclonal antibody to ERBB2 on MCF-7 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ERBB2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with anti-ERBB3 rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).
Documents Download
Request a Document
Protocol Information
ERBB2 monoclonal antibody (M05), clone 3B1 (orb2293195)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review