FAM57B Rabbit Polyclonal Antibody

SKU: orb580946

Description

Rabbit polyclonal antibody to FAM57B

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Various,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Equine, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM57B
Target	FAM57B
Protein Sequence	Synthetic peptide located within the following region: WAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWP
Molecular Weight	24kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

FAM57B, FP1188

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

FAM57B

UniProt

Q71RH2

UniProt Details

−

No UniProt data available

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	ICC, IF, IHC-Fr, IHC-P
Predicted Reactivity:	Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	PerCP/Cy5.5

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	PerCP

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	BF750